General Information

  • ID:  hor003540
  • Uniprot ID:  A0A7M7G9B6
  • Protein name:  Periviscerokinin-like
  • Gene name:  100577997
  • Organism:  Apis mellifera (Honeybee)
  • Family:  Periviscerokinin family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Apis (genus), Apini (tribe), Apinae (subfamily), Apidae (family), Apoidea (superfamily), Aculeata (infraorder), Apocrita (suborder), Hymenoptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  NA
  • GO CC:  NA

Sequence Information

  • Sequence:  AFGLLTYPRI
  • Length:  10
  • Propeptide:  MRNHLFVFLVVLSIFSVSLNRGEKLKPNMRRAFGLLTYPRIGRSNAPISNLNFNRRGVESDTDFQFYSAELDPAPDKDYEDSPAPKSLGRSMHAKHADRIPKEASWLISDRPRSSKDGSWKIDEGRSIYPFLLNSDSRNSQVNGYTPTRLDRRGNDADRILRK
  • Signal peptide:  MRNHLFVFLVVLSIFSVSLNRG
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Myotropic activity
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-A0A7M7G9B6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor003540_AF2.pdbhor003540_ESM.pdb

Physical Information

Mass: 131110 Formula: C56H87N13O13
Absent amino acids: CDEHKMNQSVW Common amino acids: L
pI: 9.35 Basic residues: 1
Polar residues: 3 Hydrophobic residues: 5
Hydrophobicity: 82 Boman Index: 286
Half-Life: 4.4 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 127
Instability Index: 1380 Extinction Coefficient cystines: 1490
Absorbance 280nm: 165.56

Literature

  • PubMed ID:  19576913
  • Title:  Mass Spectrometric Profiling of (Neuro)-Peptides in the Worker Honeybee, Apis Mellifera